—- Resource Curse – Natural Gas isWhatDetonatedtheUkraine Crisis // NAKEDKEYNESIANISM Very few, if none at all, in the West are willing to address what really triggered the latest geopolitical ‘crisis’ in the Ukraine. From Global ResearchCanada Defending Moscow’s December 18, 2013 agreement to provide Ukraine with an aid package estimated at about $15 billion, and cheaper natural gas through discounts and “gas debt forgiveness” estimated … Seguir leyendo Resource Curse – Natural Gas is What Detonated the Ukraine Crisis

—- China Composite Output and New OrdersBothFallforFirst Time inSevenMonths // Mish’s Global EconomicTrendAnalysis Sings of a global slowdown continue. The HSBC China ServicesPMI shows China Composite Output and New Orders Both Fall for First Time in Seven Months. HSBC China Composite PMI ™ data (which covers both manufacturing and services) signalled a contraction of private sector output in China, following a six-month sequence of growth. … Seguir leyendo China Composite Output and New Orders Both Fall for First Time in Seven Months

—- Stiglitz: Leavingthe Euro PainfulbutStayingin More Painful; EurozoneBreakupRecap // Mish’s Global EconomicTrendAnalysis Nobel prize winning economist Joseph E. Stiglitz has come to the right conclusion [youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI]. Question: I want to probe you a bit on that small mistake of the euro. UYou seem to suggest there is nothing that cannot be solved with more European solidarity … Seguir leyendo Stiglitz: Leaving the Euro Painful but Staying in More Painful; Eurozone Breakup Recap

—- UkraineImposes Capital Controls, LimitsForeignCurrencyWithdrawals // ZeroHedge Yesterday wereportedthat as part of the Ukrainian central bank’s plan to bailout the nation’s largely insolvent private banks, it would provide any needed funding but only "if they will remain under open control of the National Bank of Ukraine." And since the new CB head Stepan Kubiv’s allegiance to Europe were already well-known, this was merely a quick … Seguir leyendo Ukraine Imposes Capital Controls, Limits Foreign Currency Withdrawals

—- UkraineActingPresidentSaysRussia Has InvadedUkraine, As 2000 RussianTroops, MilitaryJetsArrive // ZeroHedge Here we go: UKRAINEACTINGPRESIDENTTURCHYNOVSTARTSBRIEFINGUKRAINELEADERSAYSRUSSIASTARTSAGGRESSIONAGAINSTCOUNTRYUKRAINESAYSRUSSIAINVADEDUKRAINEUNDER GUISE OFEXERCISEUKRAINELEADERSAYSRUSSIATRYINGTOPROVOKECONFLICTUKRAINELEADERSAYSRUSSIASEEKINGTOANNEXCRIMEAUKRAINE’STURCHYNOVSAYSWILLDEFENDITSINDEPENDENCEUKRAINEACTINGPRESIDENTACCUSESRUSSIAOFWORKINGON A SCENARIOLIKEBEFOREWARWITHGEORGIA More from Interpretermag.com: “Under the guise of military exercises, Russia has brought troops into the Autonomous Republic of Crimea. And not only have they seized the parliament of the Crimea, the Council of Ministers of the Crimea, they are trying to take civilian buildings under control, communications, … Seguir leyendo Ukraine Acting President Says Russia Has Invaded Ukraine, As 2000 Russian Troops, Military Jets Arrive